The lower the better Google is ranked #1 while this site is ranked #16,466,018
The number of sites linking to this website according to Alexa
PageRank™ is named after Larry Page the co-founder of Google Inc. PR is mostly a measure of the quality and quantity of backlinks. 10 is the best you can get. This website has a pagerank of 0
NSLookup performed on this domain has resolved the IP Address as 82.165.66.91. Lookup performed by 1nslookup.com if you would like to add this feature to your website visit 1nsloookup.com and grab the widget.
According to our records there is a total of 1 domain(s) on this ip address. If you know of other domains on this server please do a search for them and then they will automagically show up here.
When last checked this site was listed in Digg
When last checked this site was not listed in Twitter
When last checked this site was not Stumbled
When last checked this site was listed in DeliciousRight click the chart and select full screen for an even better view, left click and rotate the chart around, and remember when it comes to Alexa rank the lower the better.
trainingnachhilfeunterrichtschulungmathematikphysikwirtschaftmpea.de
![]() |
|
![]() |
|